PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.69GAG
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TALE
Protein Properties Length: 584aa    MW: 64515.8 Da    PI: 7.3413
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.69GAGgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.1e-093583951954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Araip.69GAG 358 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 395
                  554458******************************88 PP

2BELL109.12.6e-35222290472
         BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  el+k+kakLl +l+eVd rY++y++q++ v++sFea+ag g+a++Y +lAlka+SrhFrcLkd i eqi
  Araip.69GAG 222 ELHKRKAKLLVMLQEVDTRYEHYCNQMKGVVASFEAMAGEGAATVYSALALKAMSRHFRCLKDGILEQI 290
                  89******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-44168288IPR006563POX domain
PfamPF075264.4E-39174286IPR006563POX domain
PROSITE profilePS5007112.131336399IPR001356Homeobox domain
SMARTSM003891.5E-8339403IPR001356Homeobox domain
CDDcd000869.32E-12339400No hitNo description
SuperFamilySSF466898.55E-17340405IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-27342405IPR009057Homeodomain-like
PfamPF059207.6E-18356395IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MHAVAEGGHC VCVPQQDCMR ACGDGGTTSM SAAVCGRGHY VRGCGSGRGR YVRPAGVEWR  60
RVRAAMVGSN GSGAHIDVEK GIKLCVMVFF TIDNPGGGGG SGFVSDSEME MKWKTLFANN  120
EPPPPTCFDL ILQNTPSQGL SLSLSSNNPS SISLQSFPLR QQHHEMALQG HYSLKASRFL  180
LPAQQLLNEF CSLGTKQLNN QLIKRNKNNT NPPPLTSLDL VELHKRKAKL LVMLQEVDTR  240
YEHYCNQMKG VVASFEAMAG EGAATVYSAL ALKAMSRHFR CLKDGILEQI EATRKGMGEK  300
DPIAPGTTKG QTPRLRIIDQ ALRQQRAFHQ TISMESHPWR PQRGLPERSV SLLRAWLFEH  360
FLHPYPSDVD KHILARQTGL SRSQVSNWFI NARVRLWKPM VEEMYLEEEK EAAAASSEGG  420
GGSNTEDFQN LSPNSAARPE DQKPRLLRID SECMSSIINN SDHRKDNHQQ MNQQEEEQYL  480
GRGVADTFGS VEIDFSSYPQ GFNNSGGGAV SLTLGLQQHG GNGVSLAFPP ETHHQHQASM  540
FYSSRDQIIE DCSQPVQYSL LDGEAHAMPY RNLMGTQLLH DLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-16345403563Homeobox protein Meis2
4xrm_B6e-16345403563Homeobox protein Meis2
4xrs_A5e-16345402158Homeobox protein Meis1
4xrs_B5e-16345402158Homeobox protein Meis1
5bng_A5e-16345403159Homeobox protein Meis2
5bng_B5e-16345403159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016189480.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_016189481.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-117BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A072TUA60.0A0A072TUA6_MEDTR; BEL1-related homeotic protein
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-113TALE family protein